DPCstruct | MC4270
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 231 ± 26 aa |
| Standard deviation of domain lengths | 25.66 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 86.91 |
| Mean fraction of residues predicted as intrinsically disordered | 0.74 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 38.87 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4S4KPS0 | 1-239 | MKPQPIHITGMINRRREAHRHRSEKSEILSEWRSDLRTEAKYDELLAQNASKDGVKLETEYASHLSDWDSLLIEKQNALNRTLNREI… |
| A0A1M2VPE3 | 86-307 | LKPTLLHGPLPRVRPQPAHVTGMIVWRRKARERRLVKQELLQEQLKHVNLESEFERNLARDSKASPFEGAFDVYGDSWREPIAHDLL… |
| J4HYW0 | 1-272 | None |
| A0A1C7LW95 | 102-289 | None |
| K5VY61 | 36-278 | None |
| G4TU20 | 180-382 | None |
| A0A4Y9Y625 | 883-1110 | None |
| A0A060SVB4 | 6-239 | None |
| D8Q474 | 2-211 | None |
| A0A0K6FU15 | 32-301 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.