DPCstruct | MC42699
Metacluster Properties and Pfam Annotations
| Number of structural domains | 43 |
|---|---|
| Mean domain length (aa) | 80 ± 10 aa |
| Standard deviation of domain lengths | 9.59 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 86.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 28.70 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0361 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Z2GK97 | 66-134 | CDTNEAICLKLVRFPEDVEDDGTTFHPEYSHQIYGDDEVAFGYKGLQIQLFYTAGNLSTLFKVKYSSKV |
| H0EGK2 | 1-82 | MADSTDIWSVESNDAVHISLVTPNKTLHTFHPKFTYSIFGEEESIFGYQGLKINVKYHASDMRPLLQITYNKKFPAVGTTEP |
| A0A556U4R6 | 288-361 | None |
| A0A0D6R4V5 | 26-123 | None |
| A0A815R3L4 | 3-74 | None |
| T5AIU3 | 16-88 | None |
| A0A482WRR4 | 11-81 | None |
| R9NZF9 | 6-80 | None |
| A0A4Y7LZS8 | 14-91 | None |
| A0A2H2J0L6 | 1-93 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.