DPCstruct | MC42697
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 215 ± 17 aa |
| Standard deviation of domain lengths | 16.97 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 90.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 27.50 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14500 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| H0EGA7 | 61-303 | FIDLTPSTRLKFYKIIWVLVENYERPLLRDMGGDSFVGGLVELSELEKSAICLKDLFALYSKIGKAWSLTPDGYTQLWDCFIRYFPI… |
| A0A3P7LA74 | 11-223 | DVEKRYLQYNILEWLLLHRLQELKSLGSDFVLTFIKSMGGERHPKCLPLVFRMFVIVAQSCTLGPFVEDLFEVVACYFPVEFRQTPS… |
| T1FZR7 | 10-223 | None |
| A0A0N1P1R8 | 129-350 | None |
| A0A6A4WPE6 | 150-354 | None |
| R4X873 | 134-353 | None |
| A0A7R9KFK4 | 3-223 | None |
| A0A0N4T7H6 | 124-356 | None |
| A0A7R9I6P7 | 249-459 | None |
| A0A672KWK2 | 1-220 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.