DPCstruct | MC42690
Metacluster Properties and Pfam Annotations
| Number of structural domains | 57 |
|---|---|
| Mean domain length (aa) | 104 ± 16 aa |
| Standard deviation of domain lengths | 15.89 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 74.27 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 38.26 |
| Pfam Score | 98.28 |
| Assigned Pfam label(s) | CL0123- PF02519 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| K4AJ63 | 4-98 | KYITRKNNSHWTAKEVKLLVHGVSKFGVGRWSKLKKKYFKTSVRTAVNLKDKWRNLLRAYQKNIQKYTLLDLEPPLVEQIRKLAVKH… |
| A0A2R6X188 | 870-966 | KRRVRRPFSVSEVEALVHAVEKLGTGRWRDVKLRAFDQAKHRTYVDLKDKWKTLVHTARIAPHQRRGEPVPQELLERVTHAHTYWTA… |
| C1FDC4 | 409-513 | None |
| A0A5B8MF78 | 224-328 | None |
| A0A2G2WTM2 | 477-584 | None |
| A0A803PWS8 | 717-825 | None |
| A0A811MSB6 | 93-191 | None |
| A0A287XDM8 | 36-154 | None |
| A0A4Y7KY80 | 840-946 | None |
| A0A7I8KNG6 | 416-527 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.