DPCstruct | MC4269
Metacluster Properties and Pfam Annotations
| Number of structural domains | 56 |
|---|---|
| Mean domain length (aa) | 68 ± 11 aa |
| Standard deviation of domain lengths | 10.84 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 90.36 |
| Mean fraction of residues predicted as intrinsically disordered | 0.79 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.92 |
| Mean intra-cluster sequence similarity (%) | 61.98 |
| Pfam Score | 98.84 |
| Assigned Pfam label(s) | PF01779- CL0064 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7N4P4E6 | 1-72 | MAKSKNHTTHNQSRKWHRNGIKKPRSQRYESLKGVDPKFLRNMRFAKKHNKKGLKKMQANNAKAIKARAEAI |
| A0A4S4KPB4 | 1-69 | MAKSKNHTNHNQNKKAHRNGIKKPQSHRTLSLKGVDPKFRRNARFALTGSQKARKEQEVERSTVEREIE |
| A0A1S8VKL7 | 1-54 | None |
| A0A0E0HD75 | 1-77 | None |
| A0A0D2EJX5 | 47-109 | None |
| G7JMT5 | 137-191 | None |
| A0A2Y9N6I7 | 46-122 | None |
| A0A2S4W4I2 | 53-123 | None |
| A0A402FE67 | 23-86 | None |
| A0A6J3F383 | 24-100 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.