DPCstruct | MC42689
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 58 ± 6 aa |
| Standard deviation of domain lengths | 5.87 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 89.35 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 59.39 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0200 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J6XD46 | 60-118 | KSNLLKEVRSHEVAIAELNHLSASRAVYQKNGNIYFRTSIQKATASEQKNLDSAKAKLQ |
| K3ZYK7 | 1-60 | MKEIRAHEVAIAELDNLHPSRAVYQKAGNIFFRKSVKSVVTTEQKQLDLAKARLSKLNQA |
| A0A4S8IKL3 | 125-186 | None |
| A0A4D9BSG7 | 10-70 | None |
| A0A059C5U7 | 3-52 | None |
| A0A1B6QAV2 | 19-80 | None |
| A0A0E0Q7P3 | 130-191 | None |
| A0A445DJ75 | 9-57 | None |
| A0A7I8L1H5 | 17-81 | None |
| A0A2P6SD14 | 22-68 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.