DPCstruct | MC4268
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 89 ± 10 aa |
| Standard deviation of domain lengths | 10.21 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 88.49 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 39.56 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0028 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4S4KKA2 | 3-95 | FAQRSVLMADPNWNKGFYYDGLPPHTGMKLARQIATITYRSGPEWDQRFGRKLRPMPQDQSPDPSNPRVPALCPDFLIETYLDYQGE… |
| A0A455U4E2 | 41-141 | LSAWAAPIRLDANWNEGNYYDGEPPTDGLKEALKLVTLNANHWQWANETFNRDWADEERDPAQDINARYAIEQTLDDIAATRAETSD… |
| A0A821QRZ9 | 2-90 | None |
| A0A6P8HD22 | 633-715 | None |
| A0A847BIL7 | 133-233 | None |
| A0A838UTU6 | 14-94 | None |
| A0A5K1K0J3 | 2-90 | None |
| A0A6G3VUG2 | 11-103 | None |
| A0A848Q6Q8 | 20-108 | None |
| A0A7X6V709 | 35-133 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.