DPCstruct | MC42678
Metacluster Properties and Pfam Annotations
| Number of structural domains | 78 |
|---|---|
| Mean domain length (aa) | 70 ± 10 aa |
| Standard deviation of domain lengths | 9.97 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 86.76 |
| Mean fraction of residues predicted as intrinsically disordered | 0.51 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 47.68 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0098 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0F3PW54 | 125-189 | GVIGNAESLKQESMEGSLEYPQYTRPASWKGMEVPEVLLTGNHGEIEKWRRNASLSITAARRPDL |
| A0A510K4V5 | 17-90 | VIKKESFETDSFYNGLLGFPQYTRPVEIDGYTVPEVLRSGNHAKIDEYRQFHSIEKTMKNRMDLFEKKLENIDE |
| B0MJQ4 | 71-137 | None |
| A0A4Q4D2R3 | 160-224 | None |
| A0A2M7WZL0 | 154-244 | None |
| A0A4Q4Z9K8 | 162-225 | None |
| A0A645JIV2 | 3-71 | None |
| A0A7Y3LMT5 | 15-82 | None |
| A0A7C6SBQ4 | 1-58 | None |
| A0A2D7DV24 | 4-67 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.