DPCstruct | MC42677
Metacluster Properties and Pfam Annotations
| Number of structural domains | 38 |
|---|---|
| Mean domain length (aa) | 128 ± 19 aa |
| Standard deviation of domain lengths | 19.05 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 79.50 |
| Mean fraction of residues predicted as intrinsically disordered | 0.58 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 48.21 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A181ZU46 | 141-258 | ISHPKIDEQVCNKNHAVLKTGQGTTFDPDPKNTDAKTAQCSGLHVQGTNKFSDFAEGVGLKDNKNWPRGQAGDSGGTAKLGNADSNA… |
| A0A0F3PV75 | 13-154 | CSGDHAAITKAKGKKYVAELSTTHGNEETTQCSGLGNTTGATGPKTLSGFVNTVKVGEGKNWPRGRGSNGSSQNVEGEPNSNANAMA… |
| A0A181ZM94 | 15-140 | None |
| A0A181ZUJ5 | 83-259 | None |
| A0A181ZUV8 | 2-130 | None |
| A0A181ZL88 | 1-123 | None |
| A0A182A068 | 8-136 | None |
| A0A1G4LV67 | 1-113 | None |
| A0A1G4LXN4 | 12-118 | None |
| A0A1G4M5G5 | 1-88 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.