DPCstruct | MC42672
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 217 ± 33 aa |
| Standard deviation of domain lengths | 32.73 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 85.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 31.89 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X2BU17 | 97-283 | APTLLEHQGALFLDLNVVGVGFRYVRLNSLFAKEFSRKAQFSLESVLNWESQHTLEPPYPDAANVAQPLDFNSANARYFWEIFFHVP… |
| C0AR06 | 268-455 | TVANKPLLVRLNTLFARQLVKRANKGIDAILTLSSQRLPEPALDEGADVPMDFNGANALYFWELFYYTPMMLANVMLEGQNYDEANR… |
| A0A5C5PXB1 | 480-675 | None |
| A0A849EWZ7 | 112-347 | None |
| X7YBI6 | 737-988 | None |
| A0A7Y1CVK9 | 804-993 | None |
| A0A1V3XTY4 | 1-258 | None |
| A0A3Q9D790 | 1-168 | None |
| A0A2X4T5F1 | 2-281 | None |
| A0A3E0ACF3 | 480-721 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.