DPCstruct | MC42671
Metacluster Properties and Pfam Annotations
| Number of structural domains | 87 |
|---|---|
| Mean domain length (aa) | 126 ± 18 aa |
| Standard deviation of domain lengths | 17.89 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 86.09 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 24.57 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF18936 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1G0L8U6 | 4-107 | LFWLVWLAVVIVCVAGIWKTFEKAGKPGWACLVPIYNAFVILQIAGKPAWWFLLFLIPVVNLVVAIIVMIEIARRFGKGPGFGIGLA… |
| A0A1V6DEG8 | 19-132 | SSVVGAIGGLLGGLIGLVLGILILVATWKVYTKAGKPGWAAIVPIYNLFVLLEIVGRPGWWLILLLIPIVNLVAIFIISFDLARSFG… |
| A0A518KDM5 | 7-117 | None |
| B5ECB6 | 211-331 | None |
| A0A1V5R761 | 16-152 | None |
| A0A1G2MGY3 | 41-157 | None |
| A0A0L0LH58 | 17-142 | None |
| A0A1G1Q6T9 | 242-390 | None |
| A0A522APL8 | 121-260 | None |
| A0A7H8PNA8 | 237-331 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.