DPCstruct | MC42670
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 254 ± 21 aa |
| Standard deviation of domain lengths | 20.70 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 73.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.44 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 27.38 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A179IJ90 | 1-245 | MSTLMLHREYFSFLPTLESTPQGPVDHPMLEAAAPEGWWDESARTLFGAAENIARILHESSERGVHLMTPFAGFCAFSAGYLNLYVH… |
| A0A0G4L6L8 | 405-641 | AVHISLGYGESFTYLNLLYYVSTLMLHREYFPLLPEQDQIPQGPVDPCLQAEAPAGWWDESARELFGAAEKIARLLHETAECGGLLM… |
| A0A1L9R6T6 | 7-241 | None |
| A0A4S9CPV7 | 48-333 | None |
| A0A1G4JYV3 | 435-662 | None |
| A0A3M6WR97 | 188-459 | None |
| A0A0S7DSY2 | 488-736 | None |
| A0A6A6RNN4 | 365-629 | None |
| A0A0B2WFR8 | 52-333 | None |
| A0A136IN78 | 193-450 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.