DPCstruct | MC4267
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 128 ± 13 aa |
| Standard deviation of domain lengths | 13.21 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 84.52 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 33.18 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0271 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4S4KK14 | 3-144 | AITDLPNELLLMVFPHLPLQALIAARGVNNKWRHLAPVSDIHPIRRKLLDLYQSFVASPAFLVTRPLIEPHLCNFDRDAYLAALPES… |
| A0A5N5CUS5 | 1-118 | MSIDILPAELQLEIASYLQLRELILLRNASKHWQALINNNLSFICRARQQLLRLWDDTIHSPYFLPSRTRVLPALRPFDRIQYLHSL… |
| A0A409XZA3 | 41-166 | None |
| A0A409XXZ1 | 23-147 | None |
| A0A0C9VRY7 | 1-125 | None |
| A0A6A6B7U2 | 59-191 | None |
| A0A6A6AZD0 | 23-151 | None |
| A0A0C9V3N6 | 33-160 | None |
| R1GSM2 | 1-114 | None |
| A0A0C3C098 | 31-151 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.