DPCstruct | MC42669
Metacluster Properties and Pfam Annotations
| Number of structural domains | 65 |
|---|---|
| Mean domain length (aa) | 114 ± 17 aa |
| Standard deviation of domain lengths | 16.65 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 80.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 32.33 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04479 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A179I4Q4 | 31-124 | IIYGFTPSFALAVFAAVFFFLYLVVHTAQTIRFKSFWFITFSVGLVFEVVGYCARALSAKKDPYHLIYFVLNYFFVVTAPVFLAAGI… |
| A0A3M7JMW3 | 1-90 | MEFTFYYYTPSGAAGGIFVALFALSTLLHLYQLLRTRTWFMIPFAIGGILETIGYVGRVLSTNEAPNYTKGPYIMQSALILIAPAFL… |
| K5VN32 | 15-131 | None |
| A0A146F7L9 | 2-107 | None |
| A0A0S7DR37 | 8-111 | None |
| A0A2H3G3L9 | 4-135 | None |
| A0A1L9WGD4 | 2-91 | None |
| A0A365MVC0 | 1-103 | None |
| A0A161XZV3 | 2-113 | None |
| A0A815VC49 | 9-106 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.