DPCstruct | MC42662
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 49 ± 1 aa |
| Standard deviation of domain lengths | 0.88 |
| Length coefficient of variation | 0.02 |
| Mean AlphaFold2 pLDDT confidence score | 69.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 81.96 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0033 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| Q6DH59 | 1-51 | MDSEEKTYGGCEGPDAMYVKLISSDGHEFIVKREHALTSGTIKAMLSGPVI |
| A0A3Q3Q1C5 | 70-118 | MDGEERTYGGCEGPDAMYVKLISSDGHEFIVKREHALTSGTIKAMLSGP |
| A0A6F9CNF8 | 1-49 | None |
| A0A4U5PJA8 | 1-50 | None |
| A0A8B6HLC8 | 8-55 | None |
| A0A3L7IM67 | 1-49 | None |
| A0A2I2ZI80 | 1-49 | None |
| G3I7K8 | 1-49 | None |
| A0A0N4TH43 | 1-49 | None |
| A0A2G8KAP0 | 31-79 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.