DPCstruct | MC4266
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 346 ± 44 aa |
| Standard deviation of domain lengths | 43.81 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 81.45 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 29.16 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF11707 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0L0GAF7 | 193-492 | KVNEDPLLQTLVLTILRNAPDILHGYLCAPTITLEAKVSMRLLSTLTLVTRVLQLPLPSGFVAALSTSTRTPTHAHVHVQGHAQPHT… |
| A0A4S4KH09 | 40-376 | DVAHHFLLAVCSHPGSGICFRDRGWYPREDVDNNTQGEVQEPSAHKPGSRIYNKILGNVIKGLKVNEDSRQQELALRILTACPELVA… |
| A0A165IL36 | 2-323 | None |
| D4A7S4 | 305-706 | None |
| A0A0C9TJB1 | 2-305 | None |
| A0A7F8Q6Y8 | 1-408 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.