DPCstruct | MC42658
Metacluster Properties and Pfam Annotations
| Number of structural domains | 191 |
|---|---|
| Mean domain length (aa) | 137 ± 29 aa |
| Standard deviation of domain lengths | 28.90 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 84.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 27.05 |
| Pfam Score | 96.03 |
| Assigned Pfam label(s) | PF00238- CL0063- PF00189- CL0010- CL0021 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A679ELL8 | 10-140 | PFKPYAKSYPNKETLSKNYINFKGDIGLRLLETTYLTSTQIEAGRVAIGRVIKRKPSIRIFINAKPNRIITSKPAEVRMGKGKGSMD… |
| A0A4D9DQJ7 | 165-321 | DKVPSVPKVRREFKNLRDIRGPSTEATEFTQGQYGILALGGGYLHWGHFEMMRLTINRHLDPKIMFAVWRIPAPYKPITRKSLGQRM… |
| A0A6A4P1J3 | 2-87 | None |
| G3IBK4 | 99-254 | None |
| A0A2Y9TC15 | 66-205 | None |
| A0A4Y7NCA3 | 141-285 | None |
| A0A7R8X3N5 | 32-216 | None |
| A0A2E4HIW4 | 2-87 | None |
| C4JXM0 | 1-117 | None |
| A0A421JQG5 | 31-179 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.