DPCstruct | MC42654
Metacluster Properties and Pfam Annotations
| Number of structural domains | 80 |
|---|---|
| Mean domain length (aa) | 303 ± 73 aa |
| Standard deviation of domain lengths | 72.85 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 87.19 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 27.16 |
| Pfam Score | 84.53 |
| Assigned Pfam label(s) | PF00940- CL0126- PF14700- PF13966 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5S6Q3H1 | 642-929 | LVRLHYSSLPAAEVDKADVSEEEALPAMDCLNQLSGTPWIVNGPVLDVMLEVFRGKGNDALGIPPPPWTMPSFPKMPKQRMNTKEMA… |
| A0A6I9V3D1 | 3-175 | DEDGFYYPHNLDFRGRAYPMHPYLNHLGSDLCRGILEFAEGRPLGKSGLRWLKIHLANVYGGGVDKLSYEGRVSFTENHLGDIFDSA… |
| A0A7J6U3V7 | 518-818 | None |
| A0A0J7Y941 | 5-210 | None |
| A0A661FPC7 | 156-394 | None |
| A0A2G3CTQ6 | 7-208 | None |
| M1V872 | 636-1017 | None |
| A0A445JKJ1 | 25-377 | None |
| A0A6J1EXZ5 | 2-304 | None |
| A0A7C9F204 | 3-218 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.