DPCstruct | MC42653
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 475 ± 95 aa |
| Standard deviation of domain lengths | 94.64 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 78.97 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.41 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 19.44 |
| Pfam Score | 64.44 |
| Assigned Pfam label(s) | PF11277- PF08689 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5S6Q218 | 58-472 | TEMSTAGNQVDRFVRSAWRERWSVMKFCINLNSIRQEVDADKGKRLAALLMRYATMDEYGIEWIFQYMENCVATGVISSIALFEVIV… |
| A0A1A8BZ27 | 6-386 | LKQAILQAWKERWSDHQWAINIKKNFPKGQTWDYLNFAEALMEQAMIGPSPNPLILSYLRYAISSQMVSYSSVLTAISKFDGFSREL… |
| A0A6G0YZ34 | 254-736 | None |
| A0A6D2HAK9 | 7-441 | None |
| A0A1Y3BS40 | 1-449 | None |
| B4DDR8 | 2-351 | None |
| A0A2J7RQD3 | 1-535 | None |
| A0A1Q3ELF0 | 1-668 | None |
| U4KU83 | 179-848 | None |
| A0A6P6Y6X1 | 11-530 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.