DPCstruct | MC4265
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 115 ± 16 aa |
| Standard deviation of domain lengths | 15.99 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 78.16 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 24.60 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4S4KF02 | 45-163 | LATWPGKDRAAQYGLDKILDDGRYAPNPFVAVDTKGRTISPAQWEKSLKGADVLVKAVIIHQWYGKGREKRDNFYADIRSITVLHSF… |
| B0DPN5 | 313-415 | QEKDPGVSDEIKLSHWPAPPEYHDALADLEDTHTVAPLMAYNEKESQILPEELPSVLKGTLVEVTFTLRHYRIKNATQDSDTYTGTI… |
| A0A1J8Q7C6 | 20-134 | None |
| A0A1J8QJF1 | 15-125 | None |
| A0A369J1K3 | 27-139 | None |
| S7R786 | 103-233 | None |
| A0A1B7ML68 | 51-137 | None |
| A0A5B1QPM4 | 1-131 | None |
| M2PQQ7 | 213-356 | None |
| M2Q451 | 326-435 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.