DPCstruct | MC42640
Metacluster Properties and Pfam Annotations
| Number of structural domains | 30 |
|---|---|
| Mean domain length (aa) | 86 ± 9 aa |
| Standard deviation of domain lengths | 8.68 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 79.69 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 45.41 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05121 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6G3BC03 | 2-82 | DSEQMGRDLVALVLTVVELLRQLMERQAIRRVEQGDLSDEQVEEIGTTLMLLDQRMKELCDQHGVRPEDLNLDLGPLGTLL |
| A0A2N8TK25 | 3-75 | ALVLTVVELLRQLMERQAVHRFDEGTLRAEQEDRLGTALMLLDERMDELCEQHGLRRSDLNLDLGPLGPLLAG |
| A0A1Q7HRS9 | 8-94 | None |
| A0A7K2NWV7 | 3-66 | None |
| A0A3D1QTM9 | 15-110 | None |
| A0A7X0LNN6 | 74-168 | None |
| A0A1W2ED73 | 1-75 | None |
| A0A1G2LRM8 | 78-159 | None |
| A0A7K0C5N7 | 47-142 | None |
| A0A6N7AKE6 | 10-82 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.