DPCstruct | MC4264
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 229 ± 34 aa |
| Standard deviation of domain lengths | 33.88 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 83.31 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 20.62 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4S4K967 | 9-221 | YMLRAYAIRGILVPTVIYAQIPQMLNIFAHIERLRGLFTDRVEHMLKWDDHFKTTDHRHMNLLREDERQFIEDLPTHLGDNMRSVYR… |
| A0A1B9GE26 | 4-229 | PSPSPSLVLHALQAHLLPQPILAYLPTLLNLFAHLQLLSSKIQSEATRALVVHNKLVRRLKRKGYSDREQVLRGALSEKEGNGIASI… |
| A0A284QMM7 | 3-173 | None |
| A0A4S8L9A2 | 18-180 | None |
| A0A1C7LXW8 | 54-268 | None |
| A0A4S4LM11 | 11-244 | None |
| A0A4Y9Y9C7 | 1-211 | None |
| F8NW64 | 630-896 | None |
| A0A146IGX2 | 53-325 | None |
| A0A0H2RES1 | 29-268 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.