DPCstruct | MC42634
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 161 ± 16 aa |
| Standard deviation of domain lengths | 15.99 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 81.57 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 30.14 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| E2BD72 | 1-131 | MSQKPLRYLLNTKLKIPLTNVEVVKKLMKHPHWKTAGFHDIGKMLDYLMENFTVDEICANIHIVLYSRSVIEELLADLRKKYSQSTE… |
| A0A1Y1NKU2 | 7-144 | SLSVLCYKPEQFIAFLQQGLNMHRHEEVTKFIQQLLGSHSRRIGVNLKKHVHHRCVNLSRIEDNYEYLRELNFSREAIINAIPVLLY… |
| A0A6P3UCM3 | 225-394 | None |
| A0A6G0TQC6 | 71-248 | None |
| A0A1Y1NFP2 | 65-206 | None |
| A0A653DI43 | 137-299 | None |
| A0A811WBF1 | 263-437 | None |
| A0A2S2QG36 | 150-327 | None |
| A0A0L7LD78 | 352-508 | None |
| A0A7M7SRW4 | 184-346 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.