DPCstruct | MC42626
Metacluster Properties and Pfam Annotations
| Number of structural domains | 84 |
|---|---|
| Mean domain length (aa) | 248 ± 58 aa |
| Standard deviation of domain lengths | 58.22 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 86.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 26.20 |
| Pfam Score | 96.30 |
| Assigned Pfam label(s) | CL0137- CL0113- CL0110- PF01657- CL0202 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J0G7Q1 | 61-315 | LEDVSYALAKALEKMQDRCIERYPDLYGSDDRIQACMAELGVPLTKEVGFHQFDVYGNLFGLLAAHPIAPIVSLHHLDVVEPIFPYV… |
| A9SLD5 | 84-350 | TSQFKYTHKVGSRSAIRLARIVTEMYRFKLPKVDWFVMGDDDTIFFTDNLVRMLSKYDPTKMYYIGSQSESHWQNTEFSYGMAYGGG… |
| A0A2E0S8J0 | 63-322 | None |
| A0A6V7NXB5 | 17-246 | None |
| A0A0C3GG98 | 257-516 | None |
| A0A0G4KDR9 | 603-861 | None |
| B9FAU5 | 880-1201 | None |
| A0A6P3YT41 | 147-326 | None |
| A0A4Y1R758 | 4-172 | None |
| A0A2G3BIM1 | 1-170 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.