DPCstruct | MC42624
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 70 ± 7 aa |
| Standard deviation of domain lengths | 6.56 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 79.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 62.90 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF11708 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A026WWF6 | 260-330 | QVIRSKYEKDVFPNNHTSVWSSHWQDGKWGYKCCFSFIKNSYCTGESGKKVVEAINNNNMQNKILYTSLKQ |
| A0A6S7L7U2 | 70-142 | MALPKSKYEEDVYINNHTCVWGSWWKGHQWGYKCCKQFIRNSYCTGAAGIEAAEAASDLMKANIARKEATQEV |
| H2YSG7 | 243-324 | None |
| A0A058Z8W3 | 201-264 | None |
| A0A314YE68 | 45-122 | None |
| A0A367JD79 | 374-431 | None |
| A0A834W3B5 | 434-505 | None |
| A0A176VJV7 | 458-529 | None |
| A0A699Z2S7 | 597-661 | None |
| A0A498J1F7 | 659-727 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.