DPCstruct | MC42621
Metacluster Properties and Pfam Annotations
| Number of structural domains | 45 |
|---|---|
| Mean domain length (aa) | 144 ± 16 aa |
| Standard deviation of domain lengths | 16.31 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 92.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 49.62 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0603 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| K9B5U0 | 3-148 | LRNDALQMHKENQGKLEVTSKVKVTNKEELSLAYSPGVAEPCKDIHEDKRKVYDYTMKGITVAVVTDGTAVLGLGNIGAEASIPVME… |
| A0A171K2U4 | 1-151 | MDANFRKAALEYHEHGRPGKISVTPTKQLSNQRDLSLAYSPGVAAACEEIVDDPVNVFRYTGRGNLVGVITNGTAVLGLGNIGALAS… |
| A0A1G4UDJ0 | 2-158 | None |
| A0A0B8NJ84 | 2-108 | None |
| A0A0K2RL19 | 1-135 | None |
| A0A0T5Z150 | 1-157 | None |
| A0A256WCL2 | 7-152 | None |
| A0A2V2G218 | 188-339 | None |
| A0A661NPT9 | 3-151 | None |
| A0A1Q7GIV1 | 464-604 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.