DPCstruct | MC42620
Metacluster Properties and Pfam Annotations
| Number of structural domains | 287 |
|---|---|
| Mean domain length (aa) | 202 ± 39 aa |
| Standard deviation of domain lengths | 39.04 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 85.03 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.45 |
| Mean intra-cluster local Distance Difference Test score | 0.43 |
| Mean intra-cluster sequence similarity (%) | 13.72 |
| Pfam Score | 79.80 |
| Assigned Pfam label(s) | CL0362- PF05107 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J2S165 | 3-203 | VWEVEIELLSDLHTAGERKGSVIDVLRRDGKVYLPGSHIKGVVRTEAERIWFGKNGKRICWVTGDPYGTEKEPAGIKPCEDRSGCPV… |
| A0A661D0E2 | 1-197 | MSIKTIGIKYSEVNPLLLNNPQMVDPLNRYKKEASKITKKRNKTDDDHAELRTLEVEAKLYWDSDLGVYVPSSWVSSSIAQVAFKLE… |
| A0A1H9HCF6 | 122-376 | None |
| A0A3M2DAJ1 | 2-203 | None |
| I6Z4I9 | 2-168 | None |
| A0A3M2C5M5 | 58-283 | None |
| A0A6N7S527 | 25-267 | None |
| A0A655FUD7 | 4-169 | None |
| A0A4D8PRG9 | 1-343 | None |
| A0A2H6A1Q8 | 1-182 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.