DPCstruct | MC4262
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 318 ± 31 aa |
| Standard deviation of domain lengths | 31.48 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 86.77 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 31.90 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0029 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A167A070 | 195-516 | DLISVEYNVPRYYEEPEPVITLHVNKFAKPKPVVTERHIVPTVWDNEGLVYLARPSGVKSPQSFPLIEVANYAISVEIHPPGTKIPL… |
| A0A4S4K651 | 30-333 | ILAERLDEEVSFNIVRASSTRFTTETEFLDVSARKLALVILPPDTSYGVAEDSSGVKVLAGALSWVEVLNKLQERTSAARPFGCQTM… |
| A0A820AFM1 | 80-385 | None |
| A0A391NS51 | 6-280 | None |
| A0A0M8N8K8 | 363-703 | None |
| A0A4Q4Y1G1 | 39-359 | None |
| A0A0U1M3N0 | 453-810 | None |
| A0A821HIC4 | 902-1262 | None |
| A0A816LDP7 | 127-421 | None |
| A0A815ABS5 | 255-606 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.