DPCstruct | MC42614
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 239 ± 33 aa |
| Standard deviation of domain lengths | 33.40 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 80.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 24.66 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0P9QPU1 | 17-260 | KDFVGVGHSLGGHLATTLSRLAGDAVDAFYSFNGPGFDSSQVVGTSKAELFIDNLAAMQKQLLGYTSIADEWGAQVTDIATPTDIVN… |
| A0A099KGD3 | 191-425 | EDLNVSGHSLGGHLASTFSLLFPSVINQTSTFNSAGIVGDQFDELASAIAEVLDIVPDKVAEPNVNVIDIKSPLDPVSSLGGLHLGG… |
| A0A846TX16 | 163-407 | None |
| A0A2G2DUL7 | 180-494 | None |
| A7I2K7 | 115-334 | None |
| A0A7V5R8C5 | 107-320 | None |
| A0A518U7I8 | 29-211 | None |
| A0A518U7H3 | 124-316 | None |
| A0A2A5GH65 | 167-461 | None |
| A0A136KBT6 | 130-361 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.