DPCstruct | MC42606
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 124 ± 19 aa |
| Standard deviation of domain lengths | 18.98 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 83.18 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 37.91 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF11303 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7R9L135 | 16-129 | IASELKDAKHGIKMGQQIDGCDDAVNNLDRDWDGSPVNYTCYNPQLPLPVLPHIKSIETCDPIPDGYYPQHHCIAEQIVYNETLTTY… |
| T1KEK6 | 4-106 | QMGKVIQGCDDAKTNLELDWNNSPTDYLCFHPKNPYPVKRIKSIQECVQLPSDYYPQHFCMDTKLSYNVTLPTYGDHRPLWPVFGEY… |
| A0A812BGQ3 | 2-117 | None |
| A0A813Z1T2 | 426-560 | None |
| A0A0B2UV19 | 599-699 | None |
| A0A0S7KN55 | 31-124 | None |
| A0A182TDV3 | 4-130 | None |
| V5ID89 | 3-147 | None |
| A0A7J6ZH97 | 285-410 | None |
| A0A3R7MAH5 | 116-245 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.