DPCstruct | MC42605
Metacluster Properties and Pfam Annotations
| Number of structural domains | 167 |
|---|---|
| Mean domain length (aa) | 180 ± 35 aa |
| Standard deviation of domain lengths | 34.92 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 74.62 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 19.58 |
| Pfam Score | 98.60 |
| Assigned Pfam label(s) | CL0316- PF20146 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7R9L0J6 | 22-213 | DILKNDPKVRFISRIVSSVNVSAECRESVRNTLQSFEGLEDWAFQMLNSWGDFPPKGVMEGTITDFGDYDQCLSIEPNLSIGRSQYC… |
| A0A060ZA78 | 2-138 | NVSEKCTQDTRTFLSELNKDLPSEYAALMYDAFGKMGSDVLGGNVNRPGSLQECLSVQGPSFTGQYCQVFLKQDPIQYFVGICVPDS… |
| A0A7R9L4M2 | 13-152 | None |
| A0A7R9KUH7 | 140-357 | None |
| A0A0N1PH40 | 250-398 | None |
| A0A7R9KE01 | 165-372 | None |
| C3ZP78 | 22-177 | None |
| A0A7R9KH26 | 91-334 | None |
| A0A034VSD2 | 36-231 | None |
| A0A4C1U2Y7 | 242-458 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.