DPCstruct | MC4260
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 137 ± 20 aa |
| Standard deviation of domain lengths | 20.02 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 67.55 |
| Mean fraction of residues predicted as intrinsically disordered | 0.61 |
| Mean length-normalized TM-Score | 0.46 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 28.87 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF20236 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0C9YC20 | 1-105 | MPTPLPPSAFEGVVFTWEGEPAPPRQPTPTENPPEYETAQLPTETIKYSFSPSCLNSIVLVPPPHAQDTRPRYHITVNVNCFMPLSH… |
| A0A2R6S5A3 | 10-135 | SNVDSVNPSVPNTPVTSSSLLSLLRSSTASRSNGSALHEPTSPSVSGTSERLPGFQDSSTSARTDPVIYMFAHADQSYNGMLLQSQR… |
| A0A284QPW7 | 2-127 | None |
| A0A4Q9Q527 | 176-325 | None |
| A0A1C7MV12 | 20-155 | None |
| A0A4Y9Z8Y7 | 395-539 | None |
| A0A5B1QQT5 | 42-192 | None |
| A0A4Q9NQW1 | 102-242 | None |
| A0A4Y9YKN5 | 1-126 | None |
| A0A5C3NGF9 | 160-282 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.