DPCstruct | MC42599
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 299 ± 67 aa |
| Standard deviation of domain lengths | 66.96 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 83.20 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 22.38 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | CL0220- CL0271 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7R9KFS3 | 2-315 | TCLLPTIERMDLLVKVFHRIERFPTVSINPLENQKMRLLFECYGQLIHKVIAGWDDSEVKYVFKTMQTIAHMEQRIQTIAKSPLGAR… |
| A0A6P3HD88 | 2-210 | QTVVCSKPGSARKLELRIRLFCRNVLLDHWTHRSDSAFWLTCILKPWPMVNQARLLYIIFGPISPQDGQVVWQKMIEGPTDESCLKG… |
| A0A2B4SPK2 | 37-356 | None |
| C3ZKF1 | 185-520 | None |
| Q20775 | 173-499 | None |
| A0A2A6B439 | 101-496 | None |
| A0A821GY26 | 1-208 | None |
| A0A3P8T0L9 | 105-408 | None |
| L9JWW3 | 9-316 | None |
| A0A0N4WG87 | 15-231 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.