DPCstruct | MC42596
Metacluster Properties and Pfam Annotations
| Number of structural domains | 77 |
|---|---|
| Mean domain length (aa) | 165 ± 35 aa |
| Standard deviation of domain lengths | 35.21 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 90.94 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 31.79 |
| Pfam Score | 98.89 |
| Assigned Pfam label(s) | CL0052- CL0022 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7R9KC56 | 252-393 | GEFFSYKETARALIFKRDQSTVTNLNTLYSLMRYNNFQHDSLSQCHHYHQECQPGYAGQLAIAVRHDLNSPTGQYLYIFGRAIAGAM… |
| A0A834BZ56 | 9-128 | FSYDLCPRAKIFRRDQATVKDLDSLKHIMRFNDYKKDPYSKGDPCKSICCRNDLKSQKPSPNGCYDSKVTDFFMAGDFMAEAVNGPT… |
| A0A0M3IS46 | 116-284 | None |
| A0A2A2K7D7 | 848-1044 | None |
| A0A7S1QAX8 | 415-651 | None |
| A0A7S1PKA9 | 12-194 | None |
| A0A7S1MDZ9 | 44-242 | None |
| I0YMY4 | 270-442 | None |
| A0A5S6QFS7 | 328-485 | None |
| A0A3P7ITV8 | 1-195 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.