DPCstruct | MC42594
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 237 ± 28 aa |
| Standard deviation of domain lengths | 27.66 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 72.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 35.47 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2H5SQ92 | 294-502 | RNHGQNLQNQVNNLNQQILALQNNPPVIQQPIMAEYAPKKFRGASGEDPELWLQEFRQWCESAGLDPAANARTRVRIHGIFETLLED… |
| A0A2N0QSH9 | 8-226 | VMPELSSFEQDHEKFRDDFIAYIHLAGLNDEARIRNILDRSVKGEVREWYRREFENKNWELQNVLNNSAIGATIAHICGANAVAITG… |
| A0A2Z6R8W8 | 8-246 | None |
| A0A2Z6RFG5 | 2-223 | None |
| A0A2H5S9X9 | 4-201 | None |
| A0A2H5SL95 | 279-489 | None |
| A0A2N1N612 | 2-257 | None |
| A0A2N1NJP7 | 197-434 | None |
| A0A2N0RUZ8 | 4-213 | None |
| U9UG05 | 1-266 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.