DPCstruct | MC42593
Metacluster Properties and Pfam Annotations
| Number of structural domains | 59 |
|---|---|
| Mean domain length (aa) | 142 ± 27 aa |
| Standard deviation of domain lengths | 27.00 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 76.22 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 30.75 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2N0QMK5 | 7-137 | SCVMHQRTFSQKHCFKDINKKDEPIRDDIPTDFINDKSSHANLLYYRWLNGKSKRITSRRLGISYNSNIQARDFSTTLKTGIKHMYR… |
| A0A372R2H4 | 2-116 | NKAFHANLIFKRWKFKTWKFVNSTCTGTSYSTRYITKQPKDSANIPRFYIYHKLMKDFKFQPSPNTKVAKRQTARFERNCHRVLSKE… |
| A0A372QU66 | 1-109 | None |
| A0A372QSX5 | 1-147 | None |
| A0A372QIY0 | 77-236 | None |
| A0A397S5F0 | 204-394 | None |
| A0A2N0QT82 | 1-119 | None |
| A0A2H5RIZ9 | 1-119 | None |
| A0A2N0QK93 | 6-114 | None |
| A0A2H5RYG8 | 1-140 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.