DPCstruct | MC4259
Metacluster Properties and Pfam Annotations
| Number of structural domains | 41 |
|---|---|
| Mean domain length (aa) | 419 ± 63 aa |
| Standard deviation of domain lengths | 63.12 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 80.17 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.47 |
| Mean intra-cluster sequence similarity (%) | 18.13 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0271 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0G4MTG9 | 28-262 | PRLHLTLLPAETLHGIFQWLKPQYLSPLSRTCRFLRDYVVNNQNLCKDIYLNYFDMPPEQKGLDWEAMLHDIVRLHRLCTRPPSVPS… |
| A0A2R6S4E7 | 14-381 | IPQEVTEHILKFCHLSDVVHVAETCHDLHELICNSPDQYLWRELFLSYPFDDPRKSTARRCAVVTDWMGELRARMQAKQVVLAGASN… |
| A0A1J8QEN4 | 2-401 | None |
| W4KRI3 | 9-411 | None |
| A0A395T264 | 5-485 | None |
| G4T680 | 31-464 | None |
| A0A834RLW0 | 678-1114 | None |
| A0A438MWS1 | 472-975 | None |
| A0A146FI64 | 10-377 | None |
| A0A4Y7TY29 | 2-339 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.