DPCstruct | MC42589
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 103 ± 9 aa |
| Standard deviation of domain lengths | 8.86 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 78.02 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 46.08 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2N0QGZ2 | 6-91 | PLITLNSHNVKINPMDIPSTSVSVKKDYTSSIFDYIQRILNNPSIFPKLYFGPGIETLKKFELWHRQVWKESPLFGKTSHMIKNGN |
| A0A2H5SGJ9 | 211-319 | QFEPTHVVKNIRRFQSWRKRLPLLPIITKSIKISPKKTPSTSRGSKLSYQLSISEIIWRVLNNPMLMKHMYFGPGINSEEKSEFWHG… |
| A0A2H5RSH4 | 212-320 | None |
| A0A2I1H1W4 | 191-285 | None |
| U9URR1 | 1-74 | None |
| A0A2N1KVE2 | 3-103 | None |
| U9U9Y7 | 125-236 | None |
| A0A015KMS0 | 139-248 | None |
| A0A2H5RJ36 | 209-318 | None |
| A0A2N0REW4 | 201-299 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.