DPCstruct | MC4258
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 374 ± 36 aa |
| Standard deviation of domain lengths | 35.66 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 82.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 25.07 |
| Pfam Score | 85.32 |
| Assigned Pfam label(s) | PF17103- PF17102- PF11380 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Y2DTK0 | 2-374 | FLGMEHAPSDFFSPLFGPMMGFKSDSYNVKTLGGSGRWPTFGEKPFVYYTSYLLNHRFGLRSRHVQAHVAHSVSRAVMQEAMASFPQ… |
| A0A2R6S490 | 6-350 | PTGNRFGSRYRPYVIHEAKSASLPLLQEISQMWSSQIANTALHPFRETKAGDGDISMMFMMVHFVVERWREALLWSWTVAKHGGLDD… |
| A0A4V4ML68 | 303-638 | None |
| A0A0L0VY41 | 210-621 | None |
| A0A146HFG3 | 827-1203 | None |
| A0A066WIH4 | 737-1115 | None |
| A0A165CR40 | 4-319 | None |
| A0A165B3S8 | 159-529 | None |
| L8X4Q5 | 29-426 | None |
| M5BPU8 | 122-452 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.