DPCstruct | MC42574
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 698 ± 120 aa |
| Standard deviation of domain lengths | 120.39 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 71.06 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 24.45 |
| Pfam Score | 76.67 |
| Assigned Pfam label(s) | PF04997- PF04998- PF05000 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A819Q7D7 | 40-857 | SPRSGDFVDRSFLSGIRPQEYFFHCLIDRAVKTARIGYLRRCLMKHFEGLVVNYDLTVRDSDGSVIQFQYGEDGLAVEKCTYLKEAY… |
| A0A819MJ77 | 1-744 | KRIPFGFKHRTLPHFIKDDYGPEAKGFVENSFLKGLNPTEFFFHAMAGREGLIDTAVKTAETGYIQRRLIKAMESVMVKYDGTVRNQ… |
| A0A200QML9 | 105-785 | None |
| A0A2I0I823 | 102-784 | None |
| A0A0G4N7X0 | 325-899 | None |
| A0A7S1NCS7 | 255-1036 | None |
| A0A7R8HAJ7 | 58-598 | None |
| A0A1D6K232 | 1002-1681 | None |
| A0A446RF27 | 179-889 | None |
| A0A3M7C6S2 | 2-597 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.