DPCstruct | MC42573
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 212 ± 21 aa |
| Standard deviation of domain lengths | 20.83 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 76.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 40.77 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A819P9P3 | 1-235 | MSNSTLNEICERFLQHQVLWIKPLLNRIRQGKNEIREEIIMPTPLFDGHDGFLRVNAIFNELDDINQIRALINECAQNQSLMYSIYM… |
| A0A818XNS4 | 126-323 | VTFHNLCSKFASRNVDWINSMITQPFNQRTQDVRHYVILPTPLFESCKEFKRIDDILSSKPSSDQLRDLIKECATKRVSSYCFIIWF… |
| A0A819D3D9 | 1-215 | None |
| A0A817N6G9 | 287-512 | None |
| A0A817NRM7 | 439-672 | None |
| A0A819XCS6 | 529-725 | None |
| A0A820SDJ5 | 529-728 | None |
| A0A816VEZ1 | 4-171 | None |
| A0A819I0S3 | 1-203 | None |
| A0A817X2Y5 | 33-265 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.