DPCstruct | MC4257
Metacluster Properties and Pfam Annotations
| Number of structural domains | 43 |
|---|---|
| Mean domain length (aa) | 122 ± 16 aa |
| Standard deviation of domain lengths | 15.78 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 75.09 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 31.51 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05348 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A4JN94 | 28-137 | HDSFRFGLCKVKENLSMVHPLENSEKYFLQNEEAARLTSLRNQQGIHAPLRLAAELKATRSVGRLPFLESSGLSTAALNGSDETIDF… |
| A0A2R6RPH6 | 195-322 | SGPSKVASIQDTANSFGLHDTLTYGPRSLAAEVKKSSSVKDRLENWEATQDNLKLNLQRNAYGLHAPVRMLMERQIVGHNPHMPAFR… |
| U6LR97 | 36-175 | None |
| A0A507FME4 | 464-596 | None |
| W2RZZ8 | 72-216 | None |
| A0A7R9UMD2 | 3-110 | None |
| A0A2K6UJQ7 | 33-156 | None |
| A0A219HZL6 | 288-422 | None |
| A0A813LYJ7 | 15-122 | None |
| B9F9G3 | 1-126 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.