DPCstruct | MC42568
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 114 ± 17 aa |
| Standard deviation of domain lengths | 16.57 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 91.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 29.21 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF20345 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A395I8Z4 | 4-122 | PGRGLIALAALLTAMGGFVADWNETHVFNPQWPPHARYHNGQTMTTGLLLGLSSWFYLTRPGTQSLYTAAWLPALHLLAILSGILYP… |
| A0A4V1XWE7 | 1-116 | MLGRLLLTIDAVGLIIGSPIADCSPTHIFNPRWPPHAKFHNGQTINLSVILGLAMLYYAWRRAATPLLRREFMKVAAFVGSIYWLAG… |
| H0EC80 | 1-85 | None |
| A0A4V5N8X4 | 7-88 | None |
| A9WN55 | 34-156 | None |
| L7J8F9 | 2-137 | None |
| A0A838PFC1 | 1-127 | None |
| A0A2G2QZ70 | 7-109 | None |
| A0A5N7A200 | 2-113 | None |
| A0A1A3ECS3 | 1-87 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.