DPCstruct | MC42566
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 366 ± 88 aa |
| Standard deviation of domain lengths | 87.50 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 69.66 |
| Mean fraction of residues predicted as intrinsically disordered | 0.58 |
| Mean length-normalized TM-Score | 0.34 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 19.41 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF08202 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2H3G5X8 | 44-358 | IEAPKKRESRARPPTPLPDWDKSPQRKPPVYLATVALPVSDTPIINRNKEMPKKEGNSNSRSSLGSSGRRASSLIESDQTAIPHQEV… |
| A0A3N4KGC6 | 3-243 | TGVLAEPHPSIAHEEYYKHIHDELLEPQRMKQLLAWCGRKALTPKDGKVGDATAAAVARIIEEEVLSDVLSNPGLSSWFNREDSQPS… |
| A0A397V6U6 | 19-319 | None |
| A0A0C3DUL7 | 43-408 | None |
| M5GGA1 | 1-290 | None |
| A0A0N0RSP7 | 1-451 | None |
| A0A5C3G0M6 | 73-568 | None |
| I1CM93 | 22-369 | None |
| A0A1X2GIP0 | 16-354 | None |
| A0A1E3ISR1 | 116-560 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.