DPCstruct | MC42561
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 122 ± 13 aa |
| Standard deviation of domain lengths | 12.68 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 86.71 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 27.24 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2R4ZMT7 | 1-130 | MILLSVRKAIRDYFGRDPGEAGVVFVKAGRGVLGYVELGSRIIKINADAYRSFIDAEGVDASTEYLFVVMLHEYLHIMGILDEREVR… |
| A0A850SHA4 | 17-139 | KNFDEAFEMVKSAVFDKFKMHRAGLSLILQVMPTNLGAYHILGSNVIVMNSYVLAAIRKLSGSEGEYNAYLFMVLAHEYLHSLGITD… |
| A0A7K4FQT6 | 11-132 | None |
| A0A650CIR5 | 1-109 | None |
| A0A7C3UAE8 | 31-145 | None |
| A0A662IBC5 | 3-153 | None |
| A0A5E4J872 | 68-197 | None |
| T0Y7S3 | 1-108 | None |
| A0A7K4CP99 | 3-116 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.