DPCstruct | MC4256
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 162 ± 27 aa |
| Standard deviation of domain lengths | 26.61 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 76.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 33.25 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A401H2M3 | 1-150 | MWPGPEGAGNNHKKGYCSDGVMQKAKTVDKVLGGMTETMQEHPPDWPQPHGIFSNGTTFHPGEFLAAIRELYDCMVVKGSTGGDRAM… |
| A0A2R6RIN8 | 35-179 | RKLQTCARCHKIKYAGGVGSGKYHRKLYCSDGVKMQDKADTPSRWPQPEGIFTTRSHFHPLVFLEELRRLYEKAVIQGDSSFDNMKS… |
| A0A1J8QIU7 | 1-117 | None |
| A0A5B1QRU7 | 433-583 | None |
| A0A4Y9ZTZ8 | 84-266 | None |
| A0A401H232 | 110-296 | None |
| A0A1C7MBY2 | 242-412 | None |
| A0A1C7MQY8 | 216-349 | None |
| J0CU52 | 239-377 | None |
| A0A1C7M163 | 816-992 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.