DPCstruct | MC42558
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 201 ± 19 aa |
| Standard deviation of domain lengths | 18.96 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 86.52 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 19.13 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A354THK9 | 2-198 | FSEVLPHDAVSRGWSEARTALGDGADRQVIAERLASVVAKHPESWWHDRAKALVVSLNGSAQEVARLKTAGITAKNSPSLWLAESKM… |
| A0A5C1AR58 | 193-387 | AWAAFAGLVHAYMVRADEEALAHGERLLNLYPTEAKDEPFDQATAIVADLKRRRGKGTFGKAPAETWPDGFDTWNAARKATYLIDAL… |
| A0A5B9W5V5 | 205-456 | None |
| A0A4Q3V8J6 | 156-353 | None |
| A0A4Q2XGR5 | 55-230 | None |
| A0A517PI80 | 229-427 | None |
| B4D3W3 | 241-425 | None |
| M3I3T9 | 166-367 | None |
| A0A7W1VUU9 | 194-385 | None |
| A0A7V8J038 | 222-440 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.