DPCstruct | MC42551
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 89 ± 10 aa |
| Standard deviation of domain lengths | 9.67 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 85.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 34.59 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4R4EEF0 | 54-134 | LRLPSIGDFDIDVHLILTKKQAKEVKAHPEVYKFVPPTSTFDFLDLHESLFYPISFRAVRFVLPNGAYETVITNLSAADFP |
| A0A412ITH3 | 1-79 | MQVKRILTRKQTNEIKAHPEIYKFVPQNQRFDYFGDTPFYDFECRLVRFKITEDTYECILTNLDENEFSMQDIKKSYRL |
| N2AHS0 | 39-134 | None |
| A0A7X2H3V4 | 1-79 | None |
| F2M2T2 | 7-114 | None |
| A0A6N2W0E9 | 152-245 | None |
| A0A1G7HHQ5 | 25-114 | None |
| A7B8J5 | 11-92 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.