DPCstruct | MC4255
Metacluster Properties and Pfam Annotations
| Number of structural domains | 44 |
|---|---|
| Mean domain length (aa) | 199 ± 25 aa |
| Standard deviation of domain lengths | 25.48 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 76.92 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 28.51 |
| Pfam Score | 97.92 |
| Assigned Pfam label(s) | PF10155- PF03849 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S0LXJ1 | 2-134 | PDLVEHNPQLAIETLLRLMASSRITEYLQTLVNMPMSLHSMEVVNRLTTAVDLPSEFVHLYISNCISSCAAIKDKYMQNRLVRLVCV… |
| A0A2R6QM87 | 30-257 | DSARNTESSSTSRFPSSTPDEASERDKETERLSQGMALILAARDRVLTLAEQRVLGPLIPQLTSTPIITSHDLPPLIAHNPTLALPI… |
| T1KZP7 | 37-244 | None |
| A0A1A9UJ08 | 1-184 | None |
| A0A1S8VDE4 | 117-334 | None |
| A0A182FHF5 | 707-927 | None |
| A0A7S3LRX9 | 10-206 | None |
| A0A4T0IJY3 | 101-288 | None |
| R7UNU6 | 67-276 | None |
| A0A068V770 | 190-357 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.