DPCstruct | MC42542
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 159 ± 29 aa |
| Standard deviation of domain lengths | 28.80 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 89.38 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 28.53 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A101HKW1 | 84-204 | GIDGHGDKGVQAYCFRMTLTDHPENRIPFQKPENYQEINYELLFRNYEADNGSEVNQIPWINSPMPNRKTDTNNRRGFSTDFIGQNY… |
| A0A7V9SJ54 | 113-265 | LKEPISPYVVPGDPGSGVLPRISTAPPGEYGQADNRIQAYCYRYCVTDHPDNRIPFPKPDGYDPAQYELLLRIYQAGWRETFDKFDP… |
| A0A7C4UAF6 | 65-223 | None |
| A0A5C6AVD6 | 455-617 | None |
| A0A5C5XP70 | 663-873 | None |
| A0A3R8LAD5 | 2-212 | None |
| A0A7R9MSX1 | 1-118 | None |
| A0A072PLF0 | 2-153 | None |
| A0A840Y7R5 | 862-1060 | None |
| A0A353A1G2 | 217-385 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.